Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Laminin beta 1 Antibody (CL2970), Novus Biologicals™
SDP

Catalog No. NB396396 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396396 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396396 Supplier Novus Biologicals Supplier No. NBP24238525UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Laminin beta 1 Monoclonal antibody specifically detects Laminin beta 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Laminin beta 1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL2970
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. P07942
Gene Alias CLM, cutis laxa with marfanoid phenotype, Laminin B1 chain, laminin subunit beta-1, laminin, beta 1, Laminin-1 subunit beta, Laminin-10 subunit beta, Laminin-12 subunit beta, Laminin-2 subunit beta, Laminin-6 subunit beta, Laminin-8 subunit beta, MGC142015
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEF
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Apoptosis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 3912
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.