Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Laminin beta 3 Antibody (CL3363), Novus Biologicals™

Laminin beta 3 Antibody (CL3363), Novus Biologicals™
SDP

Catalog No. NB396386 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396386 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396386 Supplier Novus Biologicals Supplier No. NBP24662325UL
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Laminin beta 3 Monoclonal antibody specifically detects Laminin beta 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Laminin beta 3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL3363
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. Q13751
Gene Alias BM600-125KDA, Epiligrin subunit bata, FLJ99565, Kalinin B1 chain, Kalinin subunit beta, kalinin-140kDa, LAM5, Laminin 5, Laminin B1k chain, laminin S B3 chain, laminin subunit beta-3, laminin, beta 3, laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD)), Laminin-5 subunit beta, LAMNB1, Nicein subunit beta, nicein-125kDa
Host Species Mouse
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSS mLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAI mLRSADLTGLEKRVEQ
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3914
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.