Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Laminin S/Laminin beta 2 Antibody (CL2976), Novus Biologicals™

Laminin S/Laminin beta 2 Antibody (CL2976), Novus Biologicals™
SDP

Catalog No. NB396395 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396395 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396395 Supplier Novus Biologicals Supplier No. NBP24238625UL
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Laminin S/Laminin beta 2 Monoclonal antibody specifically detects Laminin S/Laminin beta 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown

Specifications

Antigen Laminin S/Laminin beta 2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone CL2976
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000-1:1000, Knockdown Validated
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. P55268
Gene Alias Laminin B1s chain, laminin S, laminin subunit beta-2, laminin, beta 2 (laminin S), Laminin-11 subunit beta, Laminin-14 subunit beta, Laminin-15 subunit beta, Laminin-3 subunit beta, Laminin-4 subunit beta, Laminin-7 subunit beta, LAMSLaminin-9 subunit beta, S-LAM beta, S-laminin subunit beta
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3913
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.