LAPTM5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21418325UL

Catalog No. NB438039

Description

LAPTM5 Polyclonal specifically detects LAPTM5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LAPTM5
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: CD40-ligand-activated specific transcripts, CLAST6, FLJ61683, FLJ97251, human retinoic acid-inducible E3 protein, KIAA0085, lysosomal associated multispanning membrane protein 5, lysosomal multispanning membrane protein 5, lysosomal protein transmembrane 5, Lysosomal-associated multitransmembrane protein 5, lysosomal-associated transmembrane protein 5, MGC125860, MGC125861, Retinoic acid-inducible E3 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7805
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: LAPTM5
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only