LARP6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157460

Catalog No. NBP157460

Description

LARP6 Polyclonal specifically detects LARP6 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: LARP6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Acheron, Achn, death-associated LA motif protein, FLJ11196, La ribonucleoprotein domain family member 6, La ribonucleoprotein domain family, member 6, la-related protein 6
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55323
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BRS8
• Gene Symbols: LARP6
• Immunogen: Synthetic peptides corresponding to LARP6(La ribonucleoprotein domain family, member 6) The peptide sequence was selected from the middle region of LARP6. Peptide sequence MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 93%; Equine: 93%; Pig: 93%; Canine: 92%; Mouse: 92%; Rat: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG