Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LARP6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$494.86
Specifications
| Antigen | LARP6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157460
|
Novus Biologicals
NBP157460 |
100 μL |
Each for $494.86
|
|
|||||
|
NBP15746020
|
Novus Biologicals
NBP15746020UL |
20 μL | N/A | N/A | N/A | ||||
Description
LARP6 Polyclonal specifically detects LARP6 in Human, Mouse samples. It is validated for Western Blot.Specifications
| LARP6 | |
| Polyclonal | |
| Rabbit | |
| Q9BRS8 | |
| 55323 | |
| Synthetic peptides corresponding to LARP6(La ribonucleoprotein domain family, member 6) The peptide sequence was selected from the middle region of LARP6. Peptide sequence MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Acheron, Achn, death-associated LA motif protein, FLJ11196, La ribonucleoprotein domain family member 6, La ribonucleoprotein domain family, member 6, la-related protein 6 | |
| LARP6 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title