Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LARP6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $501.50
Specifications
Antigen | LARP6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15746020
![]() |
Novus Biologicals
NBP15746020UL |
20 μL |
Each for $206.00
|
|
|||||
NBP157460
![]() |
Novus Biologicals
NBP157460 |
100 μL |
Each for $501.50
|
|
|||||
Description
LARP6 Polyclonal specifically detects LARP6 in Human, Mouse samples. It is validated for Western Blot.Specifications
LARP6 | |
Polyclonal | |
Rabbit | |
Q9BRS8 | |
55323 | |
Synthetic peptides corresponding to LARP6(La ribonucleoprotein domain family, member 6) The peptide sequence was selected from the middle region of LARP6. Peptide sequence MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Acheron, Achn, death-associated LA motif protein, FLJ11196, La ribonucleoprotein domain family member 6, La ribonucleoprotein domain family, member 6, la-related protein 6 | |
LARP6 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title