Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LARP6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15746020UL
Description
LARP6 Polyclonal specifically detects LARP6 in Human samples. It is validated for Western Blot.Specifications
| LARP6 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q9BRS8 | |
| LARP6 | |
| Synthetic peptides corresponding to LARP6(La ribonucleoprotein domain family, member 6) The peptide sequence was selected from the middle region of LARP6. Peptide sequence MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| Acheron, Achn, death-associated LA motif protein, FLJ11196, La ribonucleoprotein domain family member 6, La ribonucleoprotein domain family, member 6, la-related protein 6 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 55323 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction