Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP159733

LASS1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159733 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159733 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159733 Supplier Novus Biologicals Supplier No. NBP159733
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

LASS1 Polyclonal specifically detects LASS1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen LASS1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P27544
Gene Alias CerS1, LAG1 homolog, ceramide synthase 1, LAG1 longevity assurance homolog 1, LAG1MGC90349, longevity assurance (LAG1, S. cerevisiae) homolog 1, Longevity assurance gene 1 protein homolog 1, Protein UOG-1, UOG1LAG1 longevity assurance homolog 1 (S. cerevisiae), upstream of GDF1
Gene Symbols CERS1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to LASS1(LAG1 homolog, ceramide synthase 1) The peptide sequence was selected from the middle region of LASS1 (NP_067090). LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR.
Molecular Weight of Antigen 39 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10715
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Equine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.