Latent TGF-beta bp1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179806

Catalog No. NBP179806

Description

Latent TGF-beta bp1 Polyclonal specifically detects Latent TGF-beta bp1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Latent TGF-beta bp1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: latent transforming growth factor beta binding protein 1, latent-transforming growth factor beta-binding protein 1, LTBP-1, MGC163161, TGF-beta1-BP-1, Transforming growth factor beta-1-binding protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 154 kDa
• Quantity: 100 μL
• Research Discipline: Ovarian Carcinoma Cell Markers
• Gene ID (Entrez): 4052
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_000618
• Gene Symbols: LTBP1
• Immunogen: Synthetic peptide directed towards the C terminal of human LTBP1The immunogen for this antibody is LTBP1. Peptide sequence NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Horse: 86%; Pig: 83%; Rat: 83%; Mouse: 83%; Guinea pig: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG