Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Latent TGF-beta bp1 Antibody, Novus Biologicals™

Latent TGF-beta bp1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17980620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17980620 20 μL
NBP179806 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17980620 Supplier Novus Biologicals Supplier No. NBP17980620UL

Description

Rabbit Polyclonal Antibody

Latent TGF-beta bp1 Polyclonal specifically detects Latent TGF-beta bp1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Latent TGF-beta bp1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_000618
Gene Alias latent transforming growth factor beta binding protein 1, latent-transforming growth factor beta-binding protein 1, LTBP-1, MGC163161, TGF-beta1-BP-1, Transforming growth factor beta-1-binding protein 1
Gene Symbols LTBP1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human LTBP1The immunogen for this antibody is LTBP1. Peptide sequence NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK.
Molecular Weight of Antigen 154 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Ovarian Carcinoma Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 4052
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.