Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Latent TGF-beta bp1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Latent TGF-beta bp1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179806
![]() |
Novus Biologicals
NBP179806 |
100 μL |
Each for $487.50
|
|
|||||
NBP17980620
![]() |
Novus Biologicals
NBP17980620UL |
20 μL | N/A | N/A | N/A | ||||
Description
Latent TGF-beta bp1 Polyclonal specifically detects Latent TGF-beta bp1 in Human samples. It is validated for Western Blot.Specifications
Latent TGF-beta bp1 | |
Polyclonal | |
Rabbit | |
Ovarian Carcinoma Cell Markers | |
latent transforming growth factor beta binding protein 1, latent-transforming growth factor beta-binding protein 1, LTBP-1, MGC163161, TGF-beta1-BP-1, Transforming growth factor beta-1-binding protein 1 | |
LTBP1 | |
IgG | |
154 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_000618 | |
4052 | |
Synthetic peptide directed towards the C terminal of human LTBP1The immunogen for this antibody is LTBP1. Peptide sequence NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title