Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Latent TGF-beta bp1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	Latent TGF-beta bp1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP179806 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP179806	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP17980620 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17980620UL	20 μL	N/A		N/A	N/A

Description

Latent TGF-beta bp1 Polyclonal specifically detects Latent TGF-beta bp1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Latent TGF-beta bp1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Ovarian Carcinoma Cell Markers
Gene Alias	latent transforming growth factor beta binding protein 1, latent-transforming growth factor beta-binding protein 1, LTBP-1, MGC163161, TGF-beta1-BP-1, Transforming growth factor beta-1-binding protein 1
Gene Symbols	LTBP1
Isotype	IgG
Molecular Weight of Antigen	154 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	NP_000618
Gene ID (Entrez)	4052
Immunogen	Synthetic peptide directed towards the C terminal of human LTBP1The immunogen for this antibody is LTBP1. Peptide sequence NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Latent TGF-beta bp1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents