Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LBX2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP214186 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP214186 0.1 mL
NB438036 25ul
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP214186 Supplier Novus Biologicals Supplier No. NBP214186
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

LBX2 Polyclonal specifically detects LBX2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antigen LBX2
Applications Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias lady bird-like homeobox 2, ladybird homeobox 2, ladybird homeobox homolog 2, ladybird homeobox homolog 2 (Drosophila), Ladybird homeobox protein homolog 2, ladybird-like homeobox 2, ladybird-like homeodomain protein 2, transcription factor LBX2
Gene Symbols LBX2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: LKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 85474
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.