Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LC3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25474025UL
Description
LC3A Polyclonal antibody specifically detects LC3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
LC3A | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:200 - 1:500 | |
ATG8E, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, LC3, LC3A, lc3-i, ii, MAP1A/1B light chain 3 A, MAP1ALC3MAP1A/MAP1B LC3 A, MAP1BLC3MAP1A/MAP1B light chain 3 A, microtubule-associated protein 1 light chain 3 alphaMAP1 light chain 3-like protein 1, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3A | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
MAP1LC3A | |
This antibody was developed against a Recombinant LC3A Protein corresponding to amino acids: NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG | |
25 μL | |
Autophagy, Cancer, Cellular Markers, Chaperone Mediated Autophagy (CMA), Cytoskeleton Markers, Hypoxia, Macroautophagy, Neuroscience, Signal Transduction | |
84557 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction