Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LC3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | LC3A |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
LC3A Polyclonal antibody specifically detects LC3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
LC3A | |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
ATG8E, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, LC3, LC3A, lc3-i, ii, MAP1A/1B light chain 3 A, MAP1ALC3MAP1A/MAP1B LC3 A, MAP1BLC3MAP1A/MAP1B light chain 3 A, microtubule-associated protein 1 light chain 3 alphaMAP1 light chain 3-like protein 1, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3A | |
MAP1LC3A | |
IgG | |
Affinity Purified |
Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Rabbit | |
Autophagy, Cancer, Cellular Markers, Chaperone Mediated Autophagy (CMA), Cytoskeleton Markers, Hypoxia, Macroautophagy, Neuroscience, Signal Transduction | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
84557 | |
This antibody was developed against a Recombinant LC3A Protein corresponding to amino acids: NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title