Learn More
Description
Specifications
Specifications
| Antigen | LC3A |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | ATG8E, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, LC3, LC3A, lc3-i, ii, MAP1A/1B light chain 3 A, MAP1ALC3MAP1A/MAP1B LC3 A, MAP1BLC3MAP1A/MAP1B light chain 3 A, microtubule-associated protein 1 light chain 3 alphaMAP1 light chain 3-like protein 1, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3A |
| Gene Symbols | MAP1LC3A |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a Recombinant LC3A Protein corresponding to amino acids: NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
