LC3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP254740

Catalog No. NBP254740

Description

LC3A Polyclonal antibody specifically detects LC3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LC3A
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: ATG8E, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, LC3, LC3A, lc3-i, ii, MAP1A/1B light chain 3 A, MAP1ALC3MAP1A/MAP1B LC3 A, MAP1BLC3MAP1A/MAP1B light chain 3 A, microtubule-associated protein 1 light chain 3 alphaMAP1 light chain 3-like protein 1, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MAP1LC3A
• Immunogen: This antibody was developed against a Recombinant LC3A Protein corresponding to amino acids: NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG
• Quantity: 100 μL
• Research Discipline: Autophagy, Cancer, Cellular Markers, Chaperone Mediated Autophagy (CMA), Cytoskeleton Markers, Hypoxia, Macroautophagy, Neuroscience, Signal Transduction
• Gene ID (Entrez): 84557
• Target Species: Human
• Isotype: IgG

For Research Use Only