LCA5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170597

Catalog No. NBP170597

Description

LCA5L Polyclonal specifically detects LCA5L in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: LCA5L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: LCA5L
• Immunogen: Synthetic peptides corresponding to C21ORF13 The peptide sequence was selected from the N terminal of C21ORF13. Peptide sequence SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Olive baboon: 100%; Crab-eating macaque: 100%; Human: 100%;.
• Target Species: Human, Mouse, Yeast
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C21orf13, Leber congenital amaurosis 5-like, leber congenital amaurosis 5-like protein, Lebercilin-like protein, MGC33295
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 150082
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.