Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LCA5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LCA5L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LCA5L Polyclonal specifically detects LCA5L in Human, Mouse samples. It is validated for Western Blot.Specifications
LCA5L | |
Polyclonal | |
Rabbit | |
C21orf13, Leber congenital amaurosis 5-like, leber congenital amaurosis 5-like protein, Lebercilin-like protein, MGC33295 | |
LCA5L | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
150082 | |
Synthetic peptides corresponding to C21ORF13 The peptide sequence was selected from the N terminal of C21ORF13. Peptide sequence SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title