LCLAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159347

Catalog No. NBP159347

Description

LCLAT1 Polyclonal specifically detects LCLAT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LCLAT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 1-acylglycerol-3-phosphate O-acyltransferase 8, 1-AGPAT 8, Acyl-CoA:lysocardiolipin acyltransferase 1, AGPAT8lysocardiolipin acyltransferase, ALCAT11AGPAT8, EC 2.3.1.-, EC 2.3.1.51, FLJ37965, HSRG1849, LYCAT, lysocardiolipin acyltransferase 1, UNQ1849,1-AGP acyltransferase 8
• Host Species: Rabbit
• Molecular Weight of Antigen: 44 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B4DYR5
• Gene Symbols: LCLAT1
• Immunogen: Synthetic peptides corresponding to LYCAT(lysocardiolipin acyltransferase) The peptide sequence was selected from the middle region of human LYCAT. Peptide sequence YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 253558
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only