Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. LCORL Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

LCORL Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB125965 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125965 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB125965 Supplier Novus Biologicals Supplier No. NBP310532100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

LCORL Polyclonal specifically detects LCORL in Mouse samples. It is validated for Western Blot.

Specifications

Antigen LCORL
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias FLJ30696, LCoR-like protein, ligand dependent nuclear receptor corepressor-like, ligand-dependent nuclear receptor corepressor-like protein, MLR1MBLK1-related protein, transcription factor MLR1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_742165). Peptide sequence LTLQKMVTQFKEKNESLQYETSNPPVQLKIPQLRVNSVSKSQADGSGLLD
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 254251
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.