Leukotriene B4 Receptor 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25735225UL

Catalog No. NB403481

Description

Leukotriene B4 Receptor 2 Polyclonal specifically detects Leukotriene B4 Receptor 2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Leukotriene B4 Receptor 2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: BLT2LTB4 receptor JULF2, BLT2R, BLTR2LTB4-R2, JULF2, KPG_004, leukotriene B4 receptor 2, Leukotriene B4 receptor BLT2, LTB4-R 2, NOP9, Seven transmembrane receptor BLTR2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: LTB4R2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
• Quantity: 25 μL
• Research Discipline: GPCR, Immunology, Innate Immunity
• Gene ID (Entrez): 56413
• Target Species: Human
• Form: Purified

For Research Use Only