LHX6 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Alexa Fluor 532, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NB200526AF532

Catalog No. NB20526A532

Description

LHX6 Polyclonal specifically detects LHX6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence.

Specifications

• Antigen: LHX6
• Classification: Polyclonal
• Dilution: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence
• Gene Alias: LHX6.1LIM homeobox protein 6, LIM homeobox 6, LIM homeodomain protein 6.1, LIM/homeobox protein Lhx6, LIM/homeobox protein Lhx6.1, MGC119542, MGC119544, MGC119545
• Host Species: Rabbit
• Purification Method: Protein A purified
• Primary or Secondary: Primary
• Test Specificity: LHX6
• Content And Storage: Store at 4°C in the dark.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Alexa Fluor 532
• Formulation: 50 mM sodium borate with 0.05% sodium azide
• Gene Symbols: LHX6
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LHX6. Peptide Sequence LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS. The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 0.1 mL
• Gene ID (Entrez): 26468.0
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
• Isotype: IgG