Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LHX6 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Alexa Fluor 594, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB20526A594 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB20526A594 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB20526A594 Supplier Novus Biologicals Supplier No. NB200526AF594

Rabbit Polyclonal Antibody

LHX6 Polyclonal specifically detects LHX6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence.

Specifications

Antigen LHX6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 594
Dilution Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence
Formulation 50 mM sodium borate with 0.05% sodium azide
Gene Alias LHX6.1LIM homeobox protein 6, LIM homeobox 6, LIM homeodomain protein 6.1, LIM/homeobox protein Lhx6, LIM/homeobox protein Lhx6.1, MGC119542, MGC119544, MGC119545
Gene Symbols LHX6
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LHX6. Peptide Sequence LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS. The peptide sequence for this immunogen was taken from within the described region.
Purification Method Protein A purified
Quantity 0.1 mL
Primary or Secondary Primary
Gene ID (Entrez) 26468.0
Test Specificity LHX6
Target Species Human, Mouse, Rat, Bovine, Canine, Guinea Pig
Content And Storage Store at 4°C in the dark.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.