Learn More
LHX6 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Alexa Fluor 594, Polyclonal, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | LHX6 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 594 |
| Dilution | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence |
| Formulation | 50 mM sodium borate with 0.05% sodium azide |
| Gene Alias | LHX6.1LIM homeobox protein 6, LIM homeobox 6, LIM homeodomain protein 6.1, LIM/homeobox protein Lhx6, LIM/homeobox protein Lhx6.1, MGC119542, MGC119544, MGC119545 |
| Gene Symbols | LHX6 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LHX6. Peptide Sequence LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS. The peptide sequence for this immunogen was taken from within the described region. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.