LIN7C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153082

Catalog No. NBP153082

Description

LIN7C Polyclonal specifically detects LIN7C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LIN7C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ11215, lin-7 homolog C (C. elegans), Lin-7C, LIN-7-C, MALS-3LIN-7 protein 3, MALS3protein lin-7 homolog C, Mammalian lin-seven protein 3, veli-3, VELI3Lin7c, Vertebrate lin-7 homolog 3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55327
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9NUP9
• Gene Symbols: LIN7C
• Immunogen: Synthetic peptides corresponding to LIN7C(lin-7 homolog C (C. elegans)) The peptide sequence was selected from the N terminal of LIN7C. Peptide sequence MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%; Xenopus: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only