Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lipase I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156620
Description
Lipase I Polyclonal specifically detects Lipase I in Human samples. It is validated for Western Blot.Specifications
Lipase I | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Cancer/testis antigen 17, CT17membrane-associated phospholipase A1 beta, EC 3.1.1, EC 3.1.1.-, EC 3.1.1.3, EC 3.1.1.34, lipase, member I, LPD lipase, LPDLlipase member I, Membrane-associated phosphatidic acid-selective phospholipase A1-beta, mPA-PLA1 beta, PRED5 | |
Rabbit | |
Affinity purified | |
RUO | |
149998 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q6XZB0-2 | |
LIPI | |
Synthetic peptides corresponding to LIPI(lipase, member I) The peptide sequence was selected from the middle region of LIPI. Peptide sequence YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Pig: 92%; Rabbit: 85%. | |
Human, Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction