Lipase I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156620

Catalog No. NBP156620

Description

Lipase I Polyclonal specifically detects Lipase I in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Lipase I
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cancer/testis antigen 17, CT17membrane-associated phospholipase A1 beta, EC 3.1.1, EC 3.1.1.-, EC 3.1.1.3, EC 3.1.1.34, lipase, member I, LPD lipase, LPDLlipase member I, Membrane-associated phosphatidic acid-selective phospholipase A1-beta, mPA-PLA1 beta, PRED5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 149998
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6XZB0-2
• Gene Symbols: LIPI
• Immunogen: Synthetic peptides corresponding to LIPI(lipase, member I) The peptide sequence was selected from the middle region of LIPI. Peptide sequence YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 92%; Rabbit: 85%.
• Target Species: Human, Pig, Rabbit
• Isotype: IgG