Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lipase I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Lipase I |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Lipase I Polyclonal specifically detects Lipase I in Human samples. It is validated for Western Blot.Specifications
Lipase I | |
Polyclonal | |
Rabbit | |
Q6XZB0-2 | |
149998 | |
Synthetic peptides corresponding to LIPI(lipase, member I) The peptide sequence was selected from the middle region of LIPI. Peptide sequence YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Cancer/testis antigen 17, CT17membrane-associated phospholipase A1 beta, EC 3.1.1, EC 3.1.1.-, EC 3.1.1.3, EC 3.1.1.34, lipase, member I, LPD lipase, LPDLlipase member I, Membrane-associated phosphatidic acid-selective phospholipase A1-beta, mPA-PLA1 beta, PRED5 | |
LIPI | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title