LIPH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP214194

Catalog No. NBP214194

Description

LIPH Polyclonal specifically detects LIPH in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LIPH
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: ARWH2, EC 3.1.1, EC 3.1.1.-, EC 3.1.1.3, LAH2, lipase H, lipase member H, lipase, member H, LPD lipase-related protein, LPDLR, Membrane-associated phosphatidic acid-selective phospholipase A1-alpha, membrane-bound phosphatidic acid-selective phospholipase A1, mPA-PLA1, MPAPLA1, mPA-PLA1 alpha, Phospholipase A1 member B, PLA1BAH
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 200879
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: LIPH
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only