Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LIPH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | LIPH |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
LIPH Polyclonal specifically detects LIPH in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| LIPH | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 200879 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: GCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ARWH2, EC 3.1.1, EC 3.1.1.-, EC 3.1.1.3, LAH2, lipase H, lipase member H, lipase, member H, LPD lipase-related protein, LPDLR, Membrane-associated phosphatidic acid-selective phospholipase A1-alpha, membrane-bound phosphatidic acid-selective phospholipase A1, mPA-PLA1, MPAPLA1, mPA-PLA1 alpha, Phospholipase A1 member B, PLA1BAH | |
| LIPH | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title