Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Lipocalin-2/NGAL Antibody, Novus Biologicals™
SDP

Catalog No. NB430392 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB430392 25 μL
NBP190331 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB430392 Supplier Novus Biologicals Supplier No. NBP19033125UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 3 publications

Lipocalin-2/NGAL Polyclonal specifically detects Lipocalin-2/NGAL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen Lipocalin-2/NGAL
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 24p3, 25 kDa alpha-2-microglobulin-related subunit of MMP-9, HNL, LCN2, lipocalin 2, lipocalin 2 (oncogene 24p3), Lipocalin-2, migration-stimulating factor inhibitor, MSFI, neutrophil gelatinase-associated lipocalin, NGALlipocalin-2, Oncogene 24p3, p25, siderocalin
Gene Symbols LCN2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITL
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 3934
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.