Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Lipolysis Stimulated Lipoprotein Receptor Rabbit anti-Human, Polyclonal, Novus Biologicals™

Lipolysis Stimulated Lipoprotein Receptor Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB159789 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB159789 25 μg
NB159788 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB159789 Supplier Novus Biologicals Supplier No. NBP31787925UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Lipolysis Stimulated Lipoprotein Receptor Polyclonal antibody specifically detects Lipolysis Stimulated Lipoprotein Receptor in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen Lipolysis Stimulated Lipoprotein Receptor
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias ILDR3, immunoglobulin-like domain containing receptor 3, lipolysis stimulated lipoprotein receptor, lipolysis-stimulated lipoprotein receptor, lipolysis-stimulated receptor, lipolysis-stimulated remnant, LISCH, LISCH protein, LISCH7, liver-specific bHLH-Zip transcription factor, MGC10659, MGC48312, MGC48503
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSM
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 51599
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.