Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
lipoyltransferase 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15491220UL
Description
lipoyltransferase 1 Polyclonal specifically detects lipoyltransferase 1 in Human samples. It is validated for Western Blot.Specifications
lipoyltransferase 1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9Y234 | |
LIPT1 | |
Synthetic peptides corresponding to LIPT1(lipoyltransferase 1) The peptide sequence was selected from the N terminal of LIPT1. Peptide sequence NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 2.3.1.-, Lipoyl ligase, lipoyltransferase 1, mitochondrial | |
Rabbit | |
42 kDa | |
20 μL | |
Lipid and Metabolism | |
51601 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction