Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. lipoyltransferase 1 Antibody, Novus Biologicals™

lipoyltransferase 1 Antibody, Novus Biologicals™
SDP

Catalog No. NB5491220UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB5491220UL 20 μL
NBP154912 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB5491220UL Supplier Novus Biologicals Supplier No. NBP15491220UL

Description

Rabbit Polyclonal Antibody

lipoyltransferase 1 Polyclonal specifically detects lipoyltransferase 1 in Human samples. It is validated for Western Blot.

Specifications

Antigen lipoyltransferase 1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9Y234
Gene Alias EC 2.3.1.-, Lipoyl ligase, lipoyltransferase 1, mitochondrial
Gene Symbols LIPT1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to LIPT1(lipoyltransferase 1) The peptide sequence was selected from the N terminal of LIPT1. Peptide sequence NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE.
Molecular Weight of Antigen 42 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 51601
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.