Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LIR-6/LILRA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | LIR-6/LILRA1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
LIR-6/LILRA1 Polyclonal specifically detects LIR-6/LILRA1 in Human samples. It is validated for Western Blot.Specifications
| LIR-6/LILRA1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CD85 antigen-like family member I, CD85i, CD85i antigen, leukocyte immunoglobulin-like receptor subfamily A member 1, leukocyte immunoglobulin-like receptor subfamily A member 1 soluble isoform, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 1, LIR-6Leukocyte immunoglobulin-like receptor 6, LIR6MGC126563 | |
| The immunogen is a synthetic peptide directed towards the middle region of Human LIR-6/LILRA1. Peptide sequence FGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAY | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 11024 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title