Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LKB1/STK11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP256895 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP256895 100 μL
NB394247 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP256895 Supplier Novus Biologicals Supplier No. NBP256895
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

LKB1/STK11 Polyclonal specifically detects LKB1/STK11 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen LKB1/STK11
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias EC 2.7.11.1, LKB1 serine/threonine kinase 11 (Peutz-Jeghers syndrome), PJS, PJS polarization-related protein LKB1, Renal carcinoma antigen NY-REN-19, serine/threonine kinase 11, serine/threonine-protein kinase 11, Serine/threonine-protein kinase LKB1, STK11
Gene Symbols STK11
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Hypoxia Signaling, mTOR Pathway, p53 Pathway, Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 6794
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.