LMAN2 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP169474	100 μL

Catalog No. NBP169474 Supplier Novus Biologicals Supplier No. NBP169474

Description

Rabbit Polyclonal Antibody

LMAN2 Polyclonal specifically detects LMAN2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LMAN2
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q12907
• Gene Alias: C5orf8, chromosome 5 open reading frame 8, Glycoprotein GP36b, GP36B, Lectin mannose-binding 2, lectin, mannose-binding 2, vesicular integral protein of 36 kDa, vesicular integral-membrane protein VIP36, VIP36
• Gene Symbols: LMAN2
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to LMAN2(lectin, mannose-binding 2) The peptide sequence was selected from the N terminal of LMAN2. Peptide sequence SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF.
• Molecular Weight of Antigen: 36 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10960
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only