Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. LMP2/PSMB9 Antibody, Novus Biologicals™

LMP2/PSMB9 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158331 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158331 100 μL
NBP1583320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP158331 Supplier Novus Biologicals Supplier No. NBP158331
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

LMP2/PSMB9 Polyclonal specifically detects LMP2/PSMB9 in Human samples. It is validated for Western Blot.

Specifications

Antigen LMP2/PSMB9
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P28065
Gene Alias beta1i, LMP2MGC70470, Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalpeptidase 2), proteasome catalytic subunit 1i, Proteasome chain 7, proteasome subunit beta 6i, proteasome subunit beta type-9, Proteasome subunit beta-1i, proteasome-related gene 2, PSMB6iproteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalprotease 2), Really interesting new gene 12 protein, RING12EC 3.4.25.1
Gene Symbols PSMB9
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human PSMB9 Peptide sequence RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 21 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5698
Test Specificity This product is specific to Subunit or Isoform: beta type-9.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.