LMP2/PSMB9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25522925UL

Catalog No. NB395108

Description

LMP2/PSMB9 Polyclonal specifically detects LMP2/PSMB9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: LMP2/PSMB9
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: beta1i, LMP2MGC70470, Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalpeptidase 2), proteasome catalytic subunit 1i, Proteasome chain 7, proteasome subunit beta 6i, proteasome subunit beta type-9, Proteasome subunit beta-1i, proteasome-related gene 2, PSMB6iproteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalprotease 2), Really interesting new gene 12 protein, RING12EC 3.4.25.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5698
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PSMB9
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only