Lnx1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180518

Catalog No. NBP180518

Description

Lnx1 Polyclonal specifically detects Lnx1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Lnx1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.3.2.-, ligand of numb-protein X 1ligand of numb-protein X, LNXmulti-PDZ-domain-containing protein, E3 ubiquitin-protein ligase LNX, MPDZ, Numb-binding protein 1, PDZ domain-containing ring finger protein 2, PDZRN2E3 ubiquitin-protein ligase LNX
• Host Species: Rabbit
• Molecular Weight of Antigen: 70 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Hypoxia, Lipid and Metabolism, Zinc Finger
• Gene ID (Entrez): 84708
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_116011
• Gene Symbols: LNX1
• Immunogen: Synthetic peptide directed towards the C terminal of human LNX1. Peptide sequence SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG