Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lnx1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | Lnx1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18051820
|
Novus Biologicals
NBP18051820UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP180518
|
Novus Biologicals
NBP180518 |
100 μL |
Each for $487.50
|
|
|||||
Description
Lnx1 Polyclonal specifically detects Lnx1 in Human samples. It is validated for Western Blot.Specifications
| Lnx1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_116011 | |
| 84708 | |
| Synthetic peptide directed towards the C terminal of human LNX1. Peptide sequence SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA. | |
| Primary | |
| 70 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Hypoxia, Lipid and Metabolism, Zinc Finger | |
| EC 6.3.2.-, ligand of numb-protein X 1ligand of numb-protein X, LNXmulti-PDZ-domain-containing protein, E3 ubiquitin-protein ligase LNX, MPDZ, Numb-binding protein 1, PDZ domain-containing ring finger protein 2, PDZRN2E3 ubiquitin-protein ligase LNX | |
| LNX1 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title