Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LOC100360413 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP2845800.1ML

Catalog No. NB032508


Add to cart

Description

Description

LOC100360413 Polyclonal specifically detects LOC100360413 in Rat samples. It is validated for Western Blot.
Specifications

Specifications

LOC100360413
Unconjugated
Purified
Rabbit
Immunogen affinity purified
RUO
Primary
100360413
Western Blot
PBS, 2% Sucrose
eukaryotic translation elongation factor 1 alpha 1-like
The immunogen is a synthetic peptide directed towards the middle region of LOC100360413. Peptide sequence GQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
0.1ml
Store at 4°C short term. Aliquot and store at -20°:C long term. Avoid freeze-thaw cycles.
Polyclonal
Rat
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit