Learn More
Description
Specifications
Specifications
| Antigen | LOC645015 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS and 2% Sucrose with 0.09% Sodium Azide |
| Gene Alias | asparagine-linked glycosylation 1-like 8, pseudogene, LOC645015 asparagine-linked glycosylation 1 homolog pseudogene |
| Gene Symbols | LOC645015 |
| Host Species | Rabbit |
| Immunogen | Synthetic peptides corresponding to LOC645015(similar to mannosyltransferase) The peptide sequence was selected from the middle region of LOC645015. Peptide sequence LPSLVCVITGQGPLTEYYSRPIHQKHFQHIQVCNPWLEAEDYPLLLGSVD. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
