LONRF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP183578

Catalog No. NBP183578

Description

LONRF1 Polyclonal specifically detects LONRF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LONRF1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: LON peptidase N-terminal domain and ring finger 1, LON peptidase N-terminal domain and RING finger protein 1, RING finger protein 191, RNF191FLJ23749
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: LONRF1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EQDVIVNEDGRNKLKKQGETPNEVCMFSLAYGDIPEELIDVSDFECSLCMRLFFEPVTTPCGHSFCKNC
• Quantity: 0.1 mL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 91694
• Target Species: Human
• Isotype: IgG

For Research Use Only