LONRF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159292

Catalog No. NBP159292

Description

LONRF2 Polyclonal specifically detects LONRF2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LONRF2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ45273, LON peptidase N-terminal domain and ring finger 2, LON peptidase N-terminal domain and RING finger protein 2, MGC126711, Neuroblastoma apoptosis-related protease, RING finger protein 192, RNF192MGC126713
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Equine: 78%.
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q1L5Z9
• Gene Symbols: LONRF2
• Immunogen: Synthetic peptides corresponding to LONRF2(LON peptidase N-terminal domain and ring finger 2) The peptide sequence was selected from the middle region of LONRF2. Peptide sequence FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR.
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 164832
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.