Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LONRF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15929520UL
Description
LONRF2 Polyclonal specifically detects LONRF2 in Human samples. It is validated for Western Blot.Specifications
LONRF2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q1L5Z9 | |
LONRF2 | |
Synthetic peptides corresponding to LONRF2(LON peptidase N-terminal domain and ring finger 2) The peptide sequence was selected from the middle region of LONRF2. Peptide sequence IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSV. | |
20 μL | |
Zinc Finger | |
164832 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
FLJ45273, LON peptidase N-terminal domain and ring finger 2, LON peptidase N-terminal domain and RING finger protein 2, MGC126711, Neuroblastoma apoptosis-related protease, RING finger protein 192, RNF192MGC126713 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction