Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LONRF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | LONRF2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15929520
![]() |
Novus Biologicals
NBP15929520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP159295
![]() |
Novus Biologicals
NBP159295 |
100 μL |
Each for $487.50
|
|
|||||
Description
LONRF2 Polyclonal specifically detects LONRF2 in Human samples. It is validated for Western Blot.Specifications
LONRF2 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
FLJ45273, LON peptidase N-terminal domain and ring finger 2, LON peptidase N-terminal domain and RING finger protein 2, MGC126711, Neuroblastoma apoptosis-related protease, RING finger protein 192, RNF192MGC126713 | |
LONRF2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q1L5Z9 | |
164832 | |
Synthetic peptides corresponding to LONRF2(LON peptidase N-terminal domain and ring finger 2) The peptide sequence was selected from the middle region of LONRF2. Peptide sequence IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title