Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. LPAR4/LPA4 Antibody, Novus Biologicals™

LPAR4/LPA4 Antibody, Novus Biologicals™
SDP

Catalog No. NB392963 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392963 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392963 Supplier Novus Biologicals Supplier No. NBP26867125UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

LPAR4/LPA4 Polyclonal antibody specifically detects LPAR4/LPA4 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen LPAR4/LPA4
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias G protein-coupled receptor 23, GPR23P2Y purinoceptor 9, LPA4LPA-4, lysophosphatidic acid receptor 4, P2RY9G-protein coupled receptor 23, P2Y5-LIKE, P2Y5-like receptor, P2Y9LPA receptor 4, Purinergic receptor 9
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2846
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.