Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP214197

LPAR6/P2RY5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP214197 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP214197 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP214197 Supplier Novus Biologicals Supplier No. NBP214197

Description

Rabbit Polyclonal Antibody

LPAR6/P2RY5 Polyclonal specifically detects LPAR6/P2RY5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen LPAR6/P2RY5
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias G-protein coupled purinergic receptor P2Y5, LAH3, LPA receptor 6, LPA-6, lysophosphatidic acid receptor 6, MGC120358, Oleoyl-L-alpha-lysophosphatidic acid receptor, P2RY5ARWH1, P2Y purinoceptor 5, P2Y5RB intron encoded G-protein coupled receptor, Purinergic receptor 5, purinergic receptor P2Y, G-protein coupled, 5
Gene Symbols LPAR6
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: NWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESA
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline GPCR
Primary or Secondary Primary
Gene ID (Entrez) 10161
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.