Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRDD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157990
Description
LRDD Polyclonal specifically detects LRDD in Human samples. It is validated for Western Blot.Specifications
LRDD | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
leucine-rich repeat and death domain-containing protein, leucine-rich repeats and death domain containing, MGC16925, p53-induced protein with a death domain, PIDDDKFZp434D229 | |
Rabbit | |
Affinity purified | |
RUO | |
55367 | |
Human, Mouse, Rat, Bovine, Canine, Guinea Pig | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9HB75-3 | |
PIDD1 | |
Synthetic peptides corresponding to LRDD(leucine-rich repeats and death domain containing) The peptide sequence was selected from the middle region of LRDD. Peptide sequence RRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFE. | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction