Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRDD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LRDD |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LRDD Polyclonal specifically detects LRDD in Human samples. It is validated for Western Blot.Specifications
LRDD | |
Polyclonal | |
Rabbit | |
Q9HB75-3 | |
55367 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
leucine-rich repeat and death domain-containing protein, leucine-rich repeats and death domain containing, MGC16925, p53-induced protein with a death domain, PIDDDKFZp434D229 | |
Synthetic peptides corresponding to LRDD(leucine-rich repeats and death domain containing) The peptide sequence was selected from the middle region of LRDD. Peptide sequence RRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title