LRIF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156819

Catalog No. NBP156819

Description

LRIF1 Polyclonal specifically detects LRIF1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LRIF1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: LRIF1
• Immunogen: Synthetic peptides corresponding to C1ORF103 The peptide sequence was selected from the N terminal of C1ORF103. Peptide sequence KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%Chicken: 90%; Canine: 85%; Mouse: 78%;.
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ligand-dependent nuclear receptor-interacting factor 1, RP11-96K19.1, C1orf103, ligand dependent nuclear receptor interacting factor 1, RIF1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55791
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.