Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRIF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LRIF1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LRIF1 Polyclonal specifically detects LRIF1 in Human samples. It is validated for Western Blot.Specifications
LRIF1 | |
Polyclonal | |
Rabbit | |
ligand-dependent nuclear receptor-interacting factor 1, RP11-96K19.1, C1orf103, ligand dependent nuclear receptor interacting factor 1, RIF1 | |
LRIF1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
55791 | |
Synthetic peptides corresponding to C1ORF103 The peptide sequence was selected from the N terminal of C1ORF103. Peptide sequence KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title