Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LRRC3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17062420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17062420 20 μL
NBP170624 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17062420 Supplier Novus Biologicals Supplier No. NBP17062420UL

Rabbit Polyclonal Antibody

LRRC3 Polyclonal specifically detects LRRC3 in Human samples. It is validated for Western Blot.

Specifications

Antigen LRRC3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9BY71
Gene Alias C21orf102, chromosome 21 open reading frame 102, leucine rich repeat containing 3, leucine-rich repeat-containing protein 3, LRRC3A
Gene Symbols LRRC3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to LRRC3 (leucine rich repeat containing 3) The peptide sequence was selected from the middle region of LRRC3. Peptide sequence TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEA.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 81543
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.